PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g23770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 375aa    MW: 41325.1 Da    PI: 7.8577
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g23770genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32223278156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  Tp5g23770 223 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 278
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-17220281IPR009057Homeodomain-like
PROSITE profilePS5129415.086220280IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-28221281IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26223278IPR006447Myb domain, plants
PfamPF002496.1E-8225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEIDYAQKMQ RCHEYVEALE EEQKKIQVFQ RELPLCLELV TQAIEACRKE LSGTSTTSEQ  60
CSEQTTSVCI GGPVFEEFIP IKKSSMLSEE DGEHESSHEI EKSDVSNVDK KKSDWLRSVQ  120
LWNPSPDPNT KEVYDSDRLV VAKKAKVVEV RPNSNGGAFQ PFQKDKKRVF SETNLQPAVK  180
AVVTAPAPAM TTSSTTETGG ADKAGEDKIH QHQSQSPTQT HRKQRRCWSP ELHRRFLHAL  240
QQLGGSHVAT PKQIRDHMKV DGLTNDEVKS HLQKYRLHTR RPATSVTAQG NGNSQQPQFV  300
VVGGIWVPSP QDFPPPSDVA NNGGGVYTPV TAQPPPPLPP QSPKRSVDRS SGRCNSPAAS  360
SSINTTTTTS SSPVS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737217.11e-178PREDICTED: uncharacterized protein LOC106440164
TrEMBLM4FB941e-172M4FB94_BRARP; Uncharacterized protein
STRINGBra038360.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-121G2-like family protein